Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-EDG5 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EDG5. |
Rabbit Polyclonal Anti-S1PR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-S1PR2 antibody is: synthetic peptide directed towards the N-terminal region of Human S1PR2. Synthetic peptide located within the following region: MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVE |
Rabbit Polyclonal Anti-S1PR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | S1PR2 antibody was raised against an 16 amino acid peptide near the carboxy terminus of human S1PR2. |
S1PR2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human S1PR2 . |
Active filters
Target Symbol
- S1PR2
Isotypes
- IgG