Rabbit Polyclonal antibody to PFK (muscle) (phosphofructokinase, muscle)
| Applications | WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Dog, Pig, Rat, Xenopus, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 253 of PFK (muscle) (Uniprot ID#P08237) |
PFKM sheep polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Fructose-6-Phosphate Kinase is isolated and purified from Rabbit muscle. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
PFKM sheep polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Rabbit |
| Conjugation | Biotin |
| Immunogen | Fructose-6-Phosphate Kinase is isolated and purified from Rabbit muscle. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
PFKM sheep polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Fructose-6-Phosphate Kinase is isolated and purified from Rabbit muscle. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-PFKM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFKM antibody: synthetic peptide directed towards the C terminal of human PFKM. Synthetic peptide located within the following region: RALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHA |
Rabbit anti-PFKM Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PFKM |
Germany
Japan
United Kingdom
China
