Antibodies

Jump to Filters
View as table Download
OVCA1 (DPH1) Rabbit Polyclonal Antibody
TA340017

USD 539.00

5 Days

Rabbit Polyclonal Anti-DPH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DPH1 antibody: synthetic peptide directed towards the middle region of human DPH1. Synthetic peptide located within the following region: RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV
OVCA1 (DPH1) Rabbit Polyclonal Antibody
TA340016

USD 539.00

5 Days

Rabbit Polyclonal Anti-DPH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DPH1 antibody: synthetic peptide directed towards the N terminal of human DPH1. Synthetic peptide located within the following region: NQIPPEILKNPQLQAAIRVLPSNYNFEIPKTIWRIQQAQAKKVALQMPEG