Antibodies

Jump to Filters
View as table Download
Myosin light chain 3 (MYL3) Rabbit Polyclonal Antibody
TA350194

USD 380.00

In Stock

Rabbit Polyclonal Anti-MYL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MYL3
Myosin light chain 3 (MYL3) Rabbit Polyclonal Antibody
TA311754

USD 380.00

4 Weeks

Rabbit polyclonal anti-MYL3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MYL3.
Myosin light chain 3 (MYL3) Rabbit Polyclonal Antibody
TA346031

USD 539.00

5 Days

Rabbit Polyclonal Anti-MYL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYL3 antibody: synthetic peptide directed towards the N terminal of human MYL3. Synthetic peptide located within the following region: VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG