Antibodies

View as table Download

Rabbit Polyclonal Anti-NR3C2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR3C2 antibody: synthetic peptide directed towards the middle region of human NR3C2. Synthetic peptide located within the following region: RRKNCPACRLQKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPP

Rabbit Polyclonal anti-NR3C2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR3C2 antibody: synthetic peptide directed towards the N terminal of human NR3C2. Synthetic peptide located within the following region: METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSC

Rabbit Polyclonal Anti-NR3C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR3C2 antibody: synthetic peptide directed towards the C terminal of human NR3C2. Synthetic peptide located within the following region: VSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK