Antibodies

Jump to Filters
View as table Download
FN3K Rabbit Polyclonal Antibody
TA344688

USD 539.00

5 Days

Rabbit Polyclonal Anti-FN3K Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Fn3k antibody is: synthetic peptide directed towards the N-terminal region of Rat Fn3k. Synthetic peptide located within the following region: LQAQLDLIEKDYADRETQELWSRLQVKIPELFSGIEIVPALLHGDLWSGN
FN3K Rabbit Polyclonal Antibody
TA376304

USD 365.00

3 Weeks

FN3K Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human FN3K (NP_071441.1).
Modifications Unmodified