Rabbit Polyclonal Anti-CTSC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTSC antibody is: synthetic peptide directed towards the N-terminal region of Human CTSC. Synthetic peptide located within the following region: VNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGD |
Rabbit polyclonal Dipeptidyl-peptidase 1 (heavy chain, Cleaved-Arg394) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Dipeptidyl-peptidase 1. |
Rabbit Polyclonal Anti-CTSC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTSC antibody: synthetic peptide directed towards the middle region of human CTSC. Synthetic peptide located within the following region: WTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKILHLPTS |
Germany
Japan
United Kingdom
China