Antibodies

Jump to Filters
View as table Download
CPSF30 (CPSF4) Rabbit Polyclonal Antibody
TA349825

USD 380.00

In Stock

Rabbit Polyclonal Anti-CPSF4 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CPSF4
CPSF30 (CPSF4) Rabbit Polyclonal Antibody
TA349826

USD 380.00

In Stock

Rabbit Polyclonal Anti-CPSF4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CPSF4
CPSF30 (CPSF4) Rabbit Polyclonal Antibody
TA345981

USD 539.00

5 Days

Rabbit Polyclonal Anti-CPSF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPSF4 antibody: synthetic peptide directed towards the C terminal of human CPSF4. Synthetic peptide located within the following region: SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK