Rabbit Polyclonal Anti-CD200 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD200 antibody is: synthetic peptide directed towards the C-terminal region of Human CD200. Synthetic peptide located within the following region: GTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP |
Rabbit Polyclonal Anti-CD200 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD200 antibody is: synthetic peptide directed towards the C-terminal region of Human CD200. Synthetic peptide located within the following region: PRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTD |
Anti-CD200 antibody(DM156), Rabbit mAb
| Applications | ELISA, FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD200 mouse monoclonal antibody, clone OX-104, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
CD200 Rabbit pAb
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China