Antibodies

View as table Download

Rabbit Polyclonal Anti-LEFTY2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

LEFTY2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit polyclonal antibody to Lefty -A (left-right determination factor 2)

Applications IHC, WB
Reactivities Human (Predicted: Rat)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 25 and 366 of LEFTY2 (Uniprot ID#O00292)

Rabbit Polyclonal Anti-LEFTY2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEFTY2 antibody: synthetic peptide directed towards the N terminal of human LEFTY2. Synthetic peptide located within the following region: MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK

Rabbit Polyclonal Anti-LEFTY2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LEFTY2 antibody is: synthetic peptide directed towards the N-terminal region of Human LEFTY2. Synthetic peptide located within the following region: AGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLL