Antibodies

Jump to Filters
View as table Download
ALDH6A1 Rabbit Polyclonal Antibody
TA324300

USD 380.00

In Stock

Anti-ALDH6A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1
ALDH6A1 Rabbit Polyclonal Antibody
TA324301

USD 380.00

In Stock

Anti-ALDH6A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1
ALDH6A1 Rabbit Polyclonal Antibody
TA373447

USD 365.00

3 Weeks

ALDH6A1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 326-535 of human ALDH6A1 (NP_005580.1).
Modifications Unmodified
ALDH6A1 Rabbit Polyclonal Antibody
TA339014

USD 539.00

5 Days

Rabbit Polyclonal Anti-ALDH6A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH6A1 antibody: synthetic peptide directed towards the middle region of human ALDH6A1. Synthetic peptide located within the following region: GQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQW
ALDH6A1 Rabbit Polyclonal Antibody
TA339015

USD 539.00

5 Days

Rabbit Polyclonal Anti-ALDH6A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH6A1 antibody: synthetic peptide directed towards the middle region of human ALDH6A1. Synthetic peptide located within the following region: AVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLID