Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-TBX22 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human TBX22. |
Rabbit Polyclonal Anti-TBX22 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBX22 antibody: synthetic peptide directed towards the middle region of human TBX22. Synthetic peptide located within the following region: QSMHKYKPRVHVIEQGSSVDLSQIQSLPTEGVKTFSFKETEFTTVTAYQN |
Rabbit Polyclonal Anti-TBX22 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBX22 antibody: synthetic peptide directed towards the middle region of human TBX22. Synthetic peptide located within the following region: PQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPP |
Rabbit Polyclonal Anti-TBX22 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBX22 Antibody: A synthesized peptide derived from human TBX22 |
Active filters
Target Symbol
- TBX22
Reactivities
- Human
Isotypes
- IgG