Antibodies

Jump to Filters
View as table Download
PRKX Rabbit Polyclonal Antibody
TA350786

USD 380.00

In Stock

Rabbit Polyclonal Anti-PRKX Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRKX
PRKX Rabbit Polyclonal Antibody
TA366849

USD 380.00

4 Weeks

PRKX rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRKX
PRKX Rabbit Polyclonal Antibody
TA314392

USD 380.00

In Stock

Rabbit polyclonal anti-PRKX antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRKX.
PRKX Rabbit Polyclonal Antibody
TA342239

USD 539.00

5 Days

Rabbit polyclonal Anti-PRKX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKX antibody: synthetic peptide directed towards the N terminal of human PRKX. Synthetic peptide located within the following region: MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD
PRKX Rabbit Polyclonal Antibody
TA380383

USD 365.00

3 Weeks

PRKX Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 239-358 of human PRKX (NP_005035.1).
Modifications Unmodified