Antibodies

Jump to Filters
View as table Download
HAO1 Rabbit Polyclonal Antibody
TA376917

USD 365.00

3 Weeks

HAO1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-370 of human HAO1 (NP_060015.1).
Modifications Unmodified
HAO1 Rabbit Polyclonal Antibody
TA344134

USD 539.00

5 Days

Rabbit Polyclonal Anti-HAO1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAO1 antibody: synthetic peptide directed towards the C terminal of human HAO1. Synthetic peptide located within the following region: GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV