Antibodies

Jump to Filters
View as table Download
ACADM Goat Polyclonal Antibody
TA302400

USD 520.00

5 Days

Goat Polyclonal Antibody against ACADM

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RLIVAREHIDKYKN, from the C Terminus of the protein sequence according to NP_000007.1.
ACADM Rabbit Polyclonal Antibody
TA331168

USD 485.00

5 Days

Rabbit Polyclonal Anti-ACADM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACADM antibody: synthetic peptide directed towards the N terminal of human ACADM. Synthetic peptide located within the following region: ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG
ACADM Rabbit Polyclonal Antibody
TA332452

USD 365.00

3 Weeks

Rabbit anti-ACADM Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACADM
ACADM Rabbit Polyclonal Antibody
TA331167

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACADM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACADM antibody: synthetic peptide directed towards the N terminal of human ACADM. Synthetic peptide located within the following region: AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQAT