Antibodies

View as table Download

Rabbit Polyclonal Anti-CALCRL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CALCRL

CALCRL / CRLR Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human, Gibbon, Orang-Utan (Predicted: Monkey, Mouse, Rabbit)
Conjugation Unconjugated
Immunogen CALCRL / CGRP Receptor antibody was raised against synthetic 15 amino acid peptide from N-terminal extracellular domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Mouse, Rabbit (93%); Rat, Panda, Dog, Horse, Pig (87%); Goat, Bovine (80%).

CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Bovine, Dog, Xenopus, Gorilla, Goat, Human, Monkey, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan (Predicted: Mouse, Bat, Zebrafish, Guinea Pig)
Conjugation Unconjugated
Immunogen CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%).

Rabbit Polyclonal Anti-CALCRL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CALCRL antibody: synthetic peptide directed towards the N terminal of human CALCRL. Synthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL