Rabbit Polyclonal Anti-ACPT Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACPT |
Rabbit Polyclonal Anti-ACPT Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACPT |
Rabbit Polyclonal Anti-ACPT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACPT antibody: synthetic peptide directed towards the middle region of human ACPT. Synthetic peptide located within the following region: TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND |