Antibodies

Jump to Filters
View as table Download
PKMYT1 Rabbit Polyclonal Antibody
TA351532

USD 380.00

In Stock

Rabbit Polyclonal Anti-PKMYT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PKMYT1
PKMYT1 Rabbit Polyclonal Antibody
TA341798

USD 539.00

5 Days

Rabbit Polyclonal Anti-Myt1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Myt1 antibody: synthetic peptide directed towards the n terminal of mouse Myt1. Synthetic peptide located within the following region: VSKRKSHPLRLALDEGYRMDSDGSEDAEVKDVSVSDESEGPLEEAEAEMS