Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal CDC16/APC6 (Ser560) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal CDC16/APC6 (Ab-560) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P). |
Rabbit polyclonal anti-APC6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APC6. |
Rabbit polyclonal APC6 phospho T580 antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 575-588 of Human Apc6 protein. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDC16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDC16 antibody is: synthetic peptide directed towards the N-terminal region of Human CDC16. Synthetic peptide located within the following region: RYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWE |
Active filters
Target Symbol
- APC6
Reactivities
- Human
Isotypes
- IgG
Pathways
- Oocyte meiosis