Antibodies

Jump to Filters
View as table Download
OR10J3 Rabbit Polyclonal Antibody
TA316471

USD 380.00

4 Weeks

Rabbit polyclonal anti-OR10J3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10J3.
OR10J3 Rabbit Polyclonal Antibody
TA336179

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR10J3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10J3 Antibody is synthetic peptide directed towards the C-terminal region of Human OR10J3. Synthetic peptide located within the following region: HLTVVIIHYGCASIIYLKPKSQSSLGQDRLISVTYTHHSPTEPCCVQPEE