Rabbit Polyclonal RICK Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | RICK antibody was raised against a peptide corresponding to 20 amino acids near the amino terminus of human RICK. The immunogen is located within the first 50 amino acids of RICK. |
Rabbit Polyclonal Anti-RIPK2 Antibody
| Applications | IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RIPK2 antibody: synthetic peptide directed towards the middle region of human RIPK2. Synthetic peptide located within the following region: LRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT |
Rabbit anti-RIPK2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RIPK2 |
Germany
Japan
United Kingdom
China
