Antibodies

Jump to Filters
View as table Download
FMO3 Rabbit Polyclonal Antibody
TA332456

USD 365.00

3 Weeks

Rabbit anti-FMO3 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human FMO3
FMO3 Rabbit Polyclonal Antibody
TA335296

USD 539.00

5 Days

Rabbit Polyclonal Anti-Fmo3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Fmo3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KPNVKEFTETSAVFEDGTMFEAIDCVIFATGYGYAYPFLDDSIIKSRNNE