Antibodies

Jump to Filters
View as table Download
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA349647

USD 380.00

In Stock

Rabbit Polyclonal Anti-CSNK1E Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1E
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA312479

USD 380.00

In Stock

Rabbit polyclonal anti-CKI-e antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-e.
CK1 epsilon (CSNK1E) Goat Polyclonal Antibody
TA302458

USD 520.00

5 Days

Goat Polyclonal Antibody against CSNK1E

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-PASQTSVPFDHLGK, from the C Terminus of the protein sequence according to NP_001885.1; NP_689407.1.
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA340032

USD 539.00

5 Days

Rabbit Polyclonal Anti-CSNK1E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1E antibody: synthetic peptide directed towards the N terminal of human CSNK1E. Synthetic peptide located within the following region: MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH