Antibodies

Jump to Filters
View as table Download
Beta Arrestin 2 (ARRB2) Rabbit Polyclonal Antibody
TA346492

USD 539.00

5 Days

Rabbit Polyclonal Anti-ARRB2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL
Beta Arrestin 2 (ARRB2) Goat Polyclonal Antibody
TA303022

USD 520.00

5 Days

Goat Polyclonal Antibody against ARRB2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-HDHIPLPRPQS, from the internal region of the protein sequence according to NP_004304.1; NP_945355.1.