Antibodies

View as table Download

Goat Polyclonal Antibody against BDH2 / DHRS6 (aa 60 to 71)

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence C-TKKKQIDQFANE, from the internal region of the protein sequence according to NP_064524.3.

Rabbit Polyclonal Anti-BDH2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BDH2 antibody: synthetic peptide directed towards the middle region of human BDH2. Synthetic peptide located within the following region: NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR