Antibodies

Jump to Filters
View as table Download
NFAT5 Rabbit Polyclonal Antibody
TA322478

USD 380.00

In Stock

Anti-NFAT5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 711-724 amino acids of Human nuclear factor of activated T-cells 5, tonicity-responsive
NFAT5 Rabbit Polyclonal Antibody
TA343626

USD 539.00

5 Days

Rabbit Polyclonal Anti-NFAT5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFAT5 antibody: synthetic peptide directed towards the middle region of human NFAT5. Synthetic peptide located within the following region: PGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGN
NFAT5 Rabbit Polyclonal Antibody
TA315097

USD 380.00

In Stock

Rabbit polyclonal NFAT5/TonEBP (Ser155) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NFAT5/TonEBP around the phosphorylation site of serine 155 (D-N-SP-R-M).
Modifications Phospho-specific