Antibodies

View as table Download

Rabbit Polyclonal GLS2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GLS2 antibody was raised against a 18 amino acid synthetic peptide near the center terminus of human GLS2.

Anti-CA3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 260 amino acids of Human Carbonic anhydrase 3

Anti-CA3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 260 amino acids of Human Carbonic anhydrase 3

Rabbit polyclonal CA2 Antibody (N-term)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CA2.

Rabbit anti-ASNS Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 212-561 of human ASNS (NP_001664.3).

Rabbit polyclonal anti-CA1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CA1.

Rabbit Polyclonal Antibody against Glutamine Synthase

Applications ICC/IF, IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein.

Rabbit Polyclonal Anti-GLS2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GLS2 Antibody: synthetic peptide directed towards the middle region of human GLS2. Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF

Rabbit anti-GLUL Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GLUL

Rabbit Polyclonal Anti-HAL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAL antibody: synthetic peptide directed towards the C terminal of human HAL. Synthetic peptide located within the following region: EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK

Rabbit Polyclonal Anti-CTH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTH antibody: synthetic peptide directed towards the C terminal of human CTH. Synthetic peptide located within the following region: ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK

Glutamine Synthetase (GLUL) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal CA3 Antibody (Center)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CA3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 146-177 amino acids from the Central region of human CA3.

Goat Anti-carbonic anhydrase XII (aa188-199) Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SHLQHVKYKGQE, from the internal region of the protein sequence according to NP_001209.1; NP_996808.1.

Rabbit Polyclonal Anti-HAL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAL antibody: synthetic peptide directed towards the N terminal of human HAL. Synthetic peptide located within the following region: INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET