Rabbit Polyclonal Anti-ZDHHC17 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZDHHC17 antibody: synthetic peptide directed towards the middle region of human ZDHHC17. Synthetic peptide located within the following region: LFYNFGKSWKSDPGIIKATEEQKKKTIVELAETGSLDLSIFCSTCLIRKP |
Goat Polyclonal Antibody against HIP14 / ZDHHC17
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CYDQISGSGYQLV, from the C Terminus of the protein sequence according to NP_056151.1. |
Rabbit Polyclonal Anti-ZDHHC17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZDHHC17 antibody: synthetic peptide directed towards the middle region of human ZDHHC17. Synthetic peptide located within the following region: FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL |
Germany
Japan
United Kingdom
China
