Antibodies

View as table Download

Rabbit Polyclonal Anti-RHCG Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human RHCG

RHCG Antibody - C-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence NCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPL

Goat Anti-RHCG Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Dog, Pig)
Conjugation Unconjugated
Immunogen Peptide with sequence C-ERQNSVYQSD, from the internal region of the protein sequence according to NP_057405.1.

RHCG Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence QSKERQNSVYQSDLFAMIGTLFLWMYWPSFNSAISYHGDSQHRAAINTYC