Rabbit Polyclonal Anti-ALG10B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALG10B antibody is: synthetic peptide directed towards the N-terminal region of Human ALG10B. Synthetic peptide located within the following region: SVGNFYLLYLLFHKVQPRNKAASSIQRVLSTLTLAVFPTLYFFNFLYYTE |
Rabbit Polyclonal Anti-ALG10B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALG10B antibody is: synthetic peptide directed towards the middle region of Human ALG10B. Synthetic peptide located within the following region: GFCGFMFRQTNIIWAVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFA |
Germany
Japan
United Kingdom
China