Antibodies

View as table Download

ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated

Applications WB
Reactivities Human, Monkey, Rat
Conjugation Biotin

ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated

Applications WB
Reactivities Human, Monkey, Rat
Conjugation HRP

ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), Biotinylated

Applications WB
Reactivities Human, Dog, Rat, Monkey
Conjugation Biotin

ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), HRP conjugated

Applications WB
Reactivities Human, Dog, Rat, Monkey
Conjugation HRP

ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit anti-MAOB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAOB

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the middle region of human ALDH3A2. Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALDH3A2

Rabbit Polyclonal Anti-MAOB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV