Antibodies

View as table Download

Rabbit polyclonal anti-CEBPG antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CEBPG.

Anti-CEBPG Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-CEBPG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CEBPG antibody: synthetic peptide directed towards the middle region of human CEBPG. Synthetic peptide located within the following region: RNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKD

Rabbit Polyclonal Anti-CEBPG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CEBPG antibody: synthetic peptide directed towards the N terminal of human CEBPG. Synthetic peptide located within the following region: PGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDR