Antibodies

View as table Download

Rabbit Polyclonal Anti-HOXB4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXB4

Rabbit Polyclonal Anti-HOXB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXB4 antibody: synthetic peptide directed towards the N terminal of human HOXB4. Synthetic peptide located within the following region: AMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPE

Rabbit Polyclonal Anti-HOXB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXB4 antibody: synthetic peptide directed towards the N terminal of human HOXB4. Synthetic peptide located within the following region: FLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFG

Rabbit Polyclonal Anti-HOXB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXB4 antibody: synthetic peptide directed towards the C terminal of human HOXB4. Synthetic peptide located within the following region: TRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGAAGSA