Antibodies

View as table Download

PAX4 mouse monoclonal antibody,clone OTI2F3

Applications WB
Reactivities Human
Conjugation Unconjugated

PAX4 mouse monoclonal antibody,clone OTI6H4

Applications WB
Reactivities Human
Conjugation Unconjugated

PAX4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PAX4 mouse monoclonal antibody,clone OTI2F3

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PAX4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PAX4 mouse monoclonal antibody,clone OTI6H4

Applications WB
Reactivities Human
Conjugation Unconjugated

PAX4 mouse monoclonal antibody,clone 2F3, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

PAX4 mouse monoclonal antibody,clone 3H1, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

PAX4 mouse monoclonal antibody,clone 6H4, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

Rabbit Polyclonal Anti-PAX4 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the middle region of human PAX4. Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA

Goat Anti-PAX4 Antibody

Applications ELISA, WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-GKLATATSLPEDTVR, from the internal region of the protein sequence according to NP_006184.2.

PAX4 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the ?-terminal region of human PAX4 Antibody (Center).