Antibodies

View as table Download

Goat Polyclonal Antibody against PPAR delta (Isoform 1)

Applications WB
Reactivities Human, Rat (Expected from sequence similarity: Mouse, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence CHPLLQEIYKDMY, from the C Terminus of the protein sequence according to NP_006229.1.

Rabbit polyclonal PPARD Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PPARD antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 364-393 amino acids from the C-terminal region of human PPARD.

Rabbit Polyclonal Anti-PPARD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPARD Antibody: synthetic peptide directed towards the middle region of human PPARD. Synthetic peptide located within the following region: NPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIET

Rabbit anti PPARb Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The full-length recombinant protein of human PPAR-beta.

Rabbit anti PPARd Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated