Antibodies

Jump to Filters
View as table Download
ELOC Rabbit Polyclonal Antibody
TA350487

USD 380.00

In Stock

Rabbit Polyclonal Anti-TCEB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
PIAS1 Rabbit Polyclonal Antibody
TA319754

USD 570.00

5 Days

Rabbit Polyclonal PIAS1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIAS1 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human PIAS1.
PIAS2 Rabbit Polyclonal Antibody
TA319767

USD 570.00

5 Days

Rabbit Polyclonal PIAS2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIAS2 antibody was raised against a 18 amino acid synthetic peptide near the amino terminus of human PIAS2.
TRIM32 Rabbit Polyclonal Antibody
TA308451

USD 625.00

5 Days

Rabbit polyclonal antibody to TRIM32 (tripartite motif-containing 32)

Applications IF, WB
Reactivities Human (Predicted: Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 289 of TRIM32 (Uniprot ID#Q13049)
ERCC8 Rabbit Polyclonal Antibody
TA308479

USD 625.00

5 Days

Rabbit polyclonal antibody to CSA (excision repair cross-complementing rodent repair deficiency, complementation group 8)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 106 and 330 of CSA (Uniprot ID#Q13216)
E3 SUMO protein ligase PIAS4 (PIAS4) Rabbit Polyclonal Antibody
TA311668

USD 380.00

4 Weeks

Rabbit polyclonal anti-PIAS4 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIAS4.
BRCA1 Rabbit Polyclonal Antibody
TA326774

USD 365.00

3 Weeks

BRCA1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Center-peptide of human BRCA1
PML Protein (PML) Rabbit Polyclonal Antibody
TA331681

USD 539.00

5 Days

Rabbit Polyclonal Anti-PML Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PML Antibody: synthetic peptide directed towards the C terminal of human PML. Synthetic peptide located within the following region: EGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFR
KEAP1 Rabbit Polyclonal Antibody
TA337702

USD 485.00

5 Days

Rabbit Polyclonal Anti-KEAP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KEAP1 antibody: synthetic peptide directed towards the C terminal of human KEAP1. Synthetic peptide located within the following region: TWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWS
PIAS3 Rabbit Polyclonal Antibody
TA319815

USD 570.00

In Stock

Rabbit Polyclonal PIAS3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIAS3 antibody was raised against a 12 amino acid synthetic peptide near the carboxy terminus of human PIAS3.
PIAS1 Rabbit Polyclonal Antibody
TA326261

USD 380.00

In Stock

Rabbit polyclonal PIAS1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIAS1.
PIAS3 Rabbit Polyclonal Antibody
TA326269

USD 380.00

In Stock

Rabbit polyclonal PIAS3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIAS3.
TRIM32 Rabbit Polyclonal Antibody
TA329387

USD 539.00

In Stock

Rabbit Polyclonal anti-TRIM32 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32. Synthetic peptide located within the following region: GFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKE
PML Protein (PML) Rabbit Polyclonal Antibody
TA345476

USD 539.00

5 Days

Rabbit Polyclonal Anti-PML Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PML antibody: synthetic peptide directed towards the middle region of human PML. Synthetic peptide located within the following region: TTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQ
BRCA1 Rabbit Polyclonal Antibody
TA590549

USD 482.00

In Stock

Rabbit Polyclonal BRCA1 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.