GNLY mouse monoclonal antibody, clone B-L38, Purified
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
GNLY mouse monoclonal antibody, clone B-L38, Purified
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
GNLY (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 13-43 amino acids from the N-terminal region of Human GNLY |
Rabbit Polyclonal Anti-GNLY Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNLY antibody: synthetic peptide directed towards the n terminal of human GNLY. Synthetic peptide located within the following region: TRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIPSTG |
GNLY mouse monoclonal antibody, clone B-L38, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
GNLY mouse monoclonal antibody, clone B-R32, Azide Free
Reactivities | Human |
Conjugation | Unconjugated |
GNLY mouse monoclonal antibody, clone B-L38, Azide Free
Reactivities | Human |
Conjugation | Unconjugated |