FGF13 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FGF13 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FGF13 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
FGF13 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
FGF13 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
FGF13 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-FGF13 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FGF13 Antibody: synthetic peptide directed towards the middle region of human FGF13. Synthetic peptide located within the following region: PKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST |
Rabbit polyclonal anti-FGF13 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FGF13. |
Rabbit Polyclonal Anti-FGF13 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FGF13 Antibody: synthetic peptide directed towards the middle region of human FGF13. Synthetic peptide located within the following region: TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK |
FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".