Antibodies

View as table Download

FGF13 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FGF13 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

FGF13 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-FGF13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FGF13 Antibody: synthetic peptide directed towards the middle region of human FGF13. Synthetic peptide located within the following region: PKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST

Rabbit polyclonal anti-FGF13 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FGF13.

Rabbit Polyclonal Anti-FGF13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FGF13 Antibody: synthetic peptide directed towards the middle region of human FGF13. Synthetic peptide located within the following region: TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK