Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against STK35
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence ELETRMDQVTCAA, from the C Terminus of the protein sequence according to NP_543026.1. |
Rabbit Polyclonal Anti-STK35 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK35 antibody is: synthetic peptide directed towards the C-terminal region of Human STK35. Synthetic peptide located within the following region: LENPKMELHIPQKRRTSMSEGIKQLLKDMLAANPQDRPDAFELETRMDQV |
Rabbit Polyclonal Anti-STK35 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK35 antibody is: synthetic peptide directed towards the N-terminal region of Human STK35. Synthetic peptide located within the following region: PPRPRAGRRDEAGGARAAPLLLPPPPAAMETGKDGARRGTQSPERKRRSP |
Active filters
Target Symbol
- STK35
Reactivities
- Human
Families
- Protein Kinase