AMPK alpha 1 (PRKAA1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AMPK1/AMPK2 around the phosphorylation site of serine 485/491 (S-G-Sp-V-S). |
AMPK alpha 1 (PRKAA1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AMPK1/AMPK2 around the phosphorylation site of serine 485/491 (S-G-Sp-V-S). |
AMPK alpha 1 (PRKAA1) pSer486 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide derived from human AMPKα1 around the phosphorylation site of Serine 486. |
AMPK alpha 1 (PRKAA1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 470-520 of Human AMPKα1. |
Goat Polyclonal Antibody against ULK3 (aa445-458)
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Pig, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KMRESRWEADTLDK, from the C Terminus of the protein sequence according to NP_001092906.1. |
Rabbit Polyclonal Anti-PIK3R4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIK3R4 antibody: synthetic peptide directed towards the N terminal of human PIK3R4. Synthetic peptide located within the following region: HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL |
Rabbit anti AMPKa(pS79) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -CGSPN- with a phosphorylation site at Ser79 of AMPK alpha 1 protein from Carassius Auratus origin. This sequence is identical among human, mouse, rat, chicken, bovine, dog, and insect species. |
Rabbit anti AMPK-alpha(pT172) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Bovine, Chicken, Dog, Invertebrate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin |
Rabbit anti AMPK-alpha Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Bovine, Chicken, Dog, Invertebrate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin |
Goat Anti-PRKAA2, Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Peptide with sequence CPLDALNTTKP., from the internal region of the protein sequence according to NP_006243.2. |
ULK3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ULK3 |
Rabbit Polyclonal AMPK1 Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK1 |
PRKAA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PRKAA1 |
Phospho-PRKAA1-T174/T172 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T174/T172 of human PRKAA1 |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China