Antibodies

Jump to Filters
View as table Download
ADAM12 Rabbit Polyclonal Antibody
TA322850

USD 380.00

4 Weeks

Anti-ADAM12 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 223-239 amino acids of human ADAM metallopeptidase domain 12
ADAM12 Goat Polyclonal Antibody
TA302969

USD 520.00

5 Days

Goat Polyclonal Antibody against ADAM12

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence AARPLPVSPARALC, from the N Terminus of the protein sequence according to NP_003465; NP_067673.
ADAM12 Goat Polyclonal Antibody
TA326752

USD 520.00

5 Days

Goat Anti-ADAM12 (aa225-239) Antibody

Applications WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-REFQRQGKDLEKVKQ, from the internal region of the protein sequence according to NP_003465.3; NP_067673.2.
ADAM12 Rabbit Polyclonal Antibody
TA346008

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADAM12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADAM12 antibody: synthetic peptide directed towards the N terminal of human ADAM12. Synthetic peptide located within the following region: VELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVE