Rabbit polyclonal KLKB1 (heavy chain, Cleaved-Arg390) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human KLKB1.Purification: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen. |
| Modifications | Phospho-specific |
Rabbit anti-KLKB1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KLKB1 |
Rabbit Polyclonal Anti-KLKB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLKB1 antibody: synthetic peptide directed towards the middle region of human KLKB1. Synthetic peptide located within the following region: VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVS |
Germany
Japan
United Kingdom
China