Antibodies

Jump to Filters
View as table Download
Cathepsin B (CTSB) Rabbit Monoclonal Antibody [Clone ID: OTIR1C4]
TA591040

USD 516.00

In Stock

Rabbit monoclonal anti-CATB antibody for SISCAPA, clone OTIR1C4

Applications SISCAPA
Reactivities Human
Conjugation Unconjugated
Cathepsin L (CTSL) Rabbit Polyclonal Antibody
TA349265

USD 380.00

In Stock

Rabbit Polyclonal Anti-CTSL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CTSL
Cathepsin B (CTSB) Rabbit Polyclonal Antibody
TA323090

USD 380.00

In Stock

Anti-CTSB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 80-333 amino acids of human cathepsin B
Cathepsin B (CTSB) Rabbit Polyclonal Antibody
TA323091

USD 380.00

In Stock

Anti-CTSB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 80-333 amino acids of human cathepsin B
Legumain (LGMN) Rabbit Polyclonal Antibody
TA354520

USD 425.00

5 Days

Rabbit anti Legumain Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the internal sequence (a portion from 100aa-190aa) of human Legumain protein. This sequence is identical to mouse, human and rat.
Cathepsin S (CTSS) Rabbit Polyclonal Antibody
TA308573

USD 625.00

5 Days

Rabbit polyclonal antibody to Cathepsin S (cathepsin S)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 32 and 265 of Cathepsin S (Uniprot ID#P25774)
Cathepsin L (CTSL) Rabbit Polyclonal Antibody
TA313711

USD 380.00

In Stock

Rabbit polyclonal CATL1 (heavy chain, Cleaved-Thr288) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CATL1.
Legumain (LGMN) Rabbit Polyclonal Antibody
TA331335

USD 539.00

5 Days

Rabbit Polyclonal Anti-LGMN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: ESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTN
Cathepsin S (CTSS) Rabbit Polyclonal Antibody
TA343088

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-CTSS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTSS antibody: synthetic peptide directed towards the N terminal of human CTSS. Synthetic peptide located within the following region: QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEH
Legumain (LGMN) Rabbit Polyclonal Antibody
TA331334

USD 539.00

5 Days

Rabbit Polyclonal Anti-LGMN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: KMVFYIEACESGSMMNHLPDNINVYATTAANPRESSYACYYDEKRSTYLG
Cathepsin L (CTSL) Mouse Monoclonal Antibody [Clone ID: CP-L14]
AM20598PU-N

USD 560.00

2 Weeks

Cathepsin L (CTSL) mouse monoclonal antibody, clone CP-L14, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated