Antibodies

Jump to Filters
View as table Download
DUSP19 Rabbit Polyclonal Antibody
TA349309

USD 380.00

In Stock

Rabbit Polyclonal Anti-DUSP19 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DUSP19
DUSP19 Rabbit Polyclonal Antibody
TA316136

USD 380.00

4 Weeks

Rabbit polyclonal anti-DUS19 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DUS19.
DUSP19 Rabbit Polyclonal Antibody
TA340253

USD 539.00

5 Days

Rabbit Polyclonal Anti-DUSP19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DUSP19 antibody: synthetic peptide directed towards the C terminal of human DUSP19. Synthetic peptide located within the following region: SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS