Antibodies

Jump to Filters
View as table Download
Retinoic Acid Receptor gamma (RARG) Mouse Monoclonal Antibody [Clone ID: OTI3G1]
TA810381

USD 447.00

In Stock

RARG mouse monoclonal antibody, clone OTI3G1. This antibody can recognize both RARG isoform 1 (NM_000966) and isoform 2 (NM_001042728)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Retinoic Acid Receptor gamma (RARG) Rabbit Polyclonal Antibody
TA308949

USD 625.00

In Stock

Rabbit Polyclonal antibody to Retinoic Acid Receptor gamma (retinoic acid receptor, gamma)

Applications IF
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 119 and 454 of Retinoic Acid Receptor gamma
Retinoic Acid Receptor gamma (RARG) Rabbit Polyclonal Antibody
TA335181

USD 539.00

5 Days

Rabbit Polyclonal Anti-RARG Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RARG antibody: synthetic peptide directed towards the N terminal of human RARG. Synthetic peptide located within the following region: SPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPR
Retinoic Acid Receptor gamma (RARG) Rabbit Polyclonal Antibody
TA336210

USD 539.00

5 Days

Rabbit Polyclonal Anti-RARG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RARG Antibody: synthetic peptide directed towards the middle region of human RARG. Synthetic peptide located within the following region: QYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITK
Retinoic Acid Receptor gamma (RARG) Rabbit Polyclonal Antibody
TA336211

USD 539.00

5 Days

Rabbit Polyclonal Anti-RARG Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-RARG Antibody: synthetic peptide directed towards the N terminal of human RARG. Synthetic peptide located within the following region: YPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTS