Antibodies

View as table Download

Rabbit Polyclonal Anti-TRPM3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRPM3

Rabbit Polyclonal Anti-TRPM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD

Rabbit Polyclonal Anti-TRPM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: TPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTY

Rabbit Polyclonal Anti-TRPM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: YLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQK

Rabbit Polyclonal Anti-TRPM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: RPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISL