Antibodies

View as table Download

Rabbit Polyclonal Anti-KCNQ1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Hamster
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI

Rabbit Polyclonal Anti-KCNQ1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KCNQ1

Rabbit Polyclonal Anti-KCNQ1 Antibody

Applications WB
Reactivities Human, Mouse, Hamster
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS

KCNQ1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human KCNQ1

Goat Anti-KCNQ1 Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EQLTVPRRGPDEGS, from the C-Terminus of the protein sequence according to NP_000209.2; NP_861463.1.