Antibodies

Jump to Filters
View as table Download
CACNG1 Rabbit Polyclonal Antibody
TA331452

USD 539.00

5 Days

Rabbit polyclonal Anti-CACNG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNG1 antibody: synthetic peptide directed towards the N terminal of human CACNG1. Synthetic peptide located within the following region: SKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSL
CACNG1 Rabbit Polyclonal Antibody
TA313541

USD 380.00

4 Weeks

Rabbit polyclonal anti-CACNG1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CACNG1.