Rabbit Polyclonal Anti-P2RX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the N terminal of human P2RX2. Synthetic peptide located within the following region: YFVWYVFIVQKSYQESETGPESSIITKVKGITTSEHKVWDVEEYVKPPEG |
Rabbit Polyclonal Anti-P2RX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the N terminal of human P2RX2. Synthetic peptide located within the following region: VRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKGI |
Rabbit Polyclonal Anti-P2RX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the N terminal of human P2RX2. Synthetic peptide located within the following region: DGASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFH |
Rabbit Polyclonal Anti-P2RX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the middle region of human P2RX2. Synthetic peptide located within the following region: IRIDVIVHGQAGKFSLIPTIINLATALTSVGVVRNPLWGPSGCGGSTRPL |
Rabbit Polyclonal Anti-P2RX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the N terminal of human P2RX2. Synthetic peptide located within the following region: VVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKG |
Rabbit Polyclonal Anti-P2RX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX4 antibody: synthetic peptide directed towards the N terminal of human P2RX4. Synthetic peptide located within the following region: VQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIW |
Germany
Japan
United Kingdom
China