Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SSTR1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSTR1 antibody: synthetic peptide directed towards the C terminal of human SSTR1. Synthetic peptide located within the following region: RMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD |
Somatostatin Receptor 1 (SSTR1) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 20-70 of Human SSTR1 |
Rabbit Polyclonal Somatostatin Receptor 1 Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Raised against a synthetic peptide from the c-terminus of rat SSR1 receptor conjugated to cysteine. |
Rabbit Polyclonal Anti-SSTR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human (Predicted: Hamster) |
| Conjugation | Unconjugated |
| Immunogen | SSTR1 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human SSTR1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Sheep, Goat, Bovine, Bat, Horse, Rabbit, Pig (100%); Hamster, Elephant (95%). |
SSTR1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SSTR1 |
Somatostatin Receptor 1 (SSTR1) rabbit polyclonal antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SOMATOSTATIN RECEPTOR 1
Reactivities
- Human
Families
- GPCR